PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA65G00088
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family ARF
Protein Properties Length: 665aa    MW: 74593.1 Da    PI: 6.5127
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA65G00088genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.76.4e-16148230178
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT- CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegD 78 
                 f+k+lt sd++++g +++ +++a+++       +++    ++l+ +d++g +W +++i+r++++r++lt+GW+ +v++++L +g+
  AA65G00088 148 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVATDLHGSEWHFRHIFRGQPRRHLLTTGWSVYVSSKKLVAGE 230
                 99****************************964333..4459***************************************9996 PP

2Auxin_resp113.32.2e-37266348183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aaha++t+++F+v+Y+Pr+s+seF+v+v+++++a ++k+svG Rfkm+fe+ed++err+sGt+vgv++ ++  W+nS+WrsLk
  AA65G00088 266 AAHAITTGTMFSVFYKPRTSRSEFIVSVNRYLEAKNHKLSVGKRFKMRFEGEDAPERRFSGTIVGVQENKSQVWQNSEWRSLK 348
                 79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.96E-38138269IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-31145254IPR015300DNA-binding pseudobarrel domain
CDDcd100171.91E-14146240No hitNo description
PfamPF023624.5E-14148230IPR003340B3 DNA binding domain
SMARTSM010191.8E-12148242IPR003340B3 DNA binding domain
PfamPF065071.2E-34266348IPR010525Auxin response factor
PfamPF023093.5E-6514578IPR033389AUX/IAA domain
PROSITE profilePS5174526.165542635IPR000270PB1 domain
SuperFamilySSF542771.57E-10544619No hitNo description
PfamPF023099.2E-7582632IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 665 aa     Download sequence    Send to blast
MRAEKEAAIA KGWIDHCLVG LKMAFPATNQ SSGIRGGVMS DALSRELWHA CAGPLVTLPR  60
EGERVYYFPE GHMEQLEASM DQVLEQKMPS FDLPSKILCK VFNIHLRAEP ETDEVYAQIT  120
LWPEQDQSEP IGPDEPIPEP EKCTVHSFCK TLTASDTSTH GGFSVLRRHA DDCLPPLDMS  180
QQPPWQELVA TDLHGSEWHF RHIFRGQPRR HLLTTGWSVY VSSKKLVAGE NEELRVGVRR  240
HMRQQTNMPS SVISTHSMHI GVLATAAHAI TTGTMFSVFY KPRTSRSEFI VSVNRYLEAK  300
NHKLSVGKRF KMRFEGEDAP ERRFSGTIVG VQENKSQVWQ NSEWRSLKVQ WDEPSSVFRP  360
ERVSPWEVEP LVANTTPSSH SQPPQRNKRS RPPPALPSPT APGPSAPAMW KSPAESPLVP  420
MFSPPSKTAI FGNEGNKSVK GVSSNSLTFW PNRVDNAAES FVSATEKESS EKKQVNGNVC  480
RIFGITLVET HNVDECFSPA SVSGAAAVDQ PVQSNESDSN HHCEPEKSSP SFPQESQSRQ  540
IRSCTKVHMQ GSAVGRAIDL TQLNCYETLF KKLEDMFEIK DELLESAKKW QVVYTDDEND  600
MMMVGDDPWH EFCGIVKKIF IYTPEEVKKL SPKIKFPVRE ETVSKTDTNE DVNTEEKSSS  660
MAGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B0.0273713355Auxin response factor 1
4ldw_A0.0273713355Auxin response factor 1
4ldv_A0.0273713355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_849830.10.0auxin response factor 1
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLB9DGM90.0B9DGM9_ARATH; Auxin response factor
STRINGAT1G59750.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88252227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1